Anti-CD4

(0) Reviews

(1) References

(0) Validations

(0) Q&A

Catalog #: AB0091
Category: Antibodies
Family: CD Markers
Source: Goat
Application: WB, IHC (F), IHC (P)
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to CD4. CD4 is a member of the immunoglobulin superfamily, a membrane glycoprotein of T lymphocytes that interacts with major histocompatibility complex class II antigens and a receptor for the human immunodeficiency virus. This protein is expressed not only on the surface of T helper cells and regulatory T cells but also on monocytes, macrophages and dendritic cells. It functions to initiate or amplify the early phase of T-cell activation and may function as an important mediator of indirect neuronal damage in infectious and immune-mediated diseases of the central nervous system.
Alternative names: CD4mut, CD4 antigen (p55), CD4 Receptor, T-cell surface antigen T4/Leu-3 and T-cell surface glycoprotein CD4 antibody.
Gene Identifier/Accession#: Gene ID: 920, ENSG00000010610
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli.
Antigen Sequence: FHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSKLTGSG
Specificity: Using spleen lysate detects a 52 kDa band by Western blot.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:2,000
IHC (F)	1:250-1:1,000
IHC (P)	1:250-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	ND	ND
Rat	+++	+++	+++	ND	ND
Mouse	+++	+++	+++	ND	ND
Canine	+++	+++	+++	ND	ND
Monkey	+++	+++	+++	ND	ND

External References (1)

Helsby MA, Leader PM, Fenn JR, et al. BMC Cell Biol. 2014 Feb 14;15:6.

PMID: 24528853

Images

	Endogenous CD4 detected at 1/500 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.
	IHC of human lymph node using anti-CD4 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD4 Ab at 1:750/DAB detection.
	IHC of human appendix using anti-CD4 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD4 Ab at 1:750/DAB detection.
	IHC of mouse spleen using anti-CD4 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD4 Ab at 1:750/DAB detection.
	IHC of mouse kidney carcinoma using anti-CD4 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD4 Ab at 1:750/DAB detection.
	IHC of mouse liver using anti-CD4 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD4 Ab at 1:750/DAB detection.