Anti-CD31

(0) Reviews

(9) References

(0) Validations

(0) Q&A

Catalog #: AB0092
Category: Antibodies
Family: CD Markers
Source: Goat
Application: WB, IHC (F), IHC (P)
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to CD31. CD31 is a 130-140 kDa type I transmembrane glycoprotein. It is expressed in platelets, granulocytes, stem cells of myeloid lineage, monocytes and endothelial cells. It is likely to be involved in integrin activation, leukocyte migration and angiogenesis.
Alternative names: CD31/endoCAM, endoCAM, PECA1, PECAM1, PECAM-1, platelet/endothelial adhesion molecule 1 antibody.
Gene Identifier/Accession#: Gene ID: 5175, ENSG00000261371
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli.
Antigen Sequence: TEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Specificity: Using PBM cell lysates detects a 130-140 kDa band by Western blot.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	ND	ND
Rat	+++	+++	+++	ND	ND
Mouse	+++	+++	+++	ND	ND
Canine	+++	+++	+++	ND	ND
Monkey	+++	+++	+++	ND	ND

External References (9)

Ferreira JV, Soares AR, Ramalho JS, et al. Scientific Reports 5. May 2015	PMID: 25958982
Sacramento JF, Ribeiro MJ, Rodrigues T, et al. Respir Physiol Neurobiol 2016 Jul	PMID: 26993367
Rodrigues T, Matafome P, Sereno J, et al. Sci Rep 2017 May	PMID: 28490763
Fonseca LMO, MSc Thesis, University of Berlin, Germany 2018
Rodrigues TDA, PhD Thesis, University of Coimbra, Portugal 2018
Ferreira JV, Rosa Soares A, Ramalho JS, et al. PLoS One. 2019 Oct	PMID: 31613922
Rodrigues T, Borges P, Mar L, et al. Pharmacol Res 2020 Sep.	PMID: 32942016
Martins FO, Sacramento JF, Olea E, et al. Antioxidants (Basel) 2021 Aug	PMID: 34439481
Ferreira JV, Soares AR, Ramalho J, et al. Sci Adv 2022 Mar	PMID: 35333565

Images

	IHC of human lymph node using anti-CD31 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD31 Ab at 1:750/DAB detection;
	Endogenous CD31 detected at 1/500 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of human breast carcinoma using anti-CD31 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD31 Ab at 1:750/DAB detection;
	IHC of mouse spleen using anti-CD31 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD31 Ab at 1:750/DAB detection;
	IHC of mouse lung using anti-CD31 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD31 Ab at 1:750/DAB detection;
	IHC of mouse kidney using anti-CD31 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD31 Ab at 1:750/DAB detection;