Anti-beta-Catenin

(0) Reviews

(3) References

(0) Validations

(0) Q&A

Catalog #: AB0095
Category: Antibodies
Family: Cancer
Source: Goat
Application: WB, IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to Catenin (cadherin-associated protein), beta 1. Beta Catenin is a 88 kDa protein and is a key downstream effector in the Wnt signalling pathway. It is involved in early embryonic development and tumorigenesis. Beta Catenin is part of a complex of proteins that constitute adherens junctions, necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. This protein anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete.
Alternative names: cadherin-associated protein, CTNNB, CTNNB1, MRD19, armadillo antibody.
Gene Identifier/Accession#: Gene ID: 1499, ENSG00000168036
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
Antigen Sequence: MDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Specificity: Detects a band of approximately 95 kDa by Western blot in MNT1 and SH-SY5Y cell lysates.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:2,000
IF	1:50-1:250
IHC (P)	1:250-1:1,000
IHC (P)	1:250-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (3)

Balashova OA, Visina O, Borodinsky LN. Development 2017 Mar 2.	PMID: 28255006
Armando F, Godizzi F, Razzuoli E, et al. Animals (Basel) 2020 Dec.	PMID: 33297475
Armando F, Gambini M, Corradi A, et al. J Cell Mol Med 2020 Aug	PMID: 32627957

Images

	Confocal immunofluorescence – anti-Catenin beta1 Ab in BEAS-2B cells at 1/250 dilution; cells were fixed with 4% of PFA;
	IHC of mouse intestine using anti-CTNNB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTNNB1 Ab at 1:500/DAB detection;
	IHC of mouse liver using anti-CTNNB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTNNB1 Ab at 1:500/DAB detection;
	Anti-beta-Catenin Ab at 1/1,000 dilution; lysate at 100 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of mouse brain using anti-CTNNB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTNNB1 Ab at 1:500/DAB detection;
	IHC of mouse lung using anti-CTNNB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTNNB1 Ab at 1:500/DAB detection;
	Confocal immunofluorescence – anti-Catenin beta1 Ab in BEAS-2B cells at 1/250 dilution; cells were fixed with 4% of PFA;
	IHC of mouse retina using anti-CTNNB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTNNB1 Ab at 1:500/DAB detection;