anti-ERBB1
- Catalog #
- AB0106
- Category
- Antibodies
- Family
- Cancer
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to ERBB1. ERBB1 is a transmembrane glycoprotein that is a member of the protein kinase superfamily and a receptor for members of the epidermal growth factor family. It is a cell surface protein that binds to epidermal growth factor inducing receptor dimerization and tyrosine autophosphorylation and leading to cell proliferation. This receptor has been associated with cancer. Different protein isoforms encoded by multiple alternatively spliced transcript variants have been found for this gene.
- Alternative names
- EGFR, epidermal growth factor receptor, ERBB, HER1, mENA, NISBD2PIG61, antibody.
- Gene Identifier/Accession#
- Gene ID: 1956, ENSG00000146648
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.
- Antigen Sequence
- SHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
- Specificity
- This antibody gives a positive signal in the following human (HaCat, SKOV3 and H69) whole cell lysates by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of mouse liver using anti ERBB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB1 Ab at 1:500/DAB detection. 
Anti-ERBB1 Ab at 1:2,500 dilution; 50 µg of total protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human placenta using anti-ERBB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB1 Ab at 1:500/DAB detection. 
IHC of mouse intestine using anti-ERBB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB1 Ab at 1:500/DAB detection. 
IHC of rat eye using anti-ERBB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB1 Ab at 1:500/DAB detection. 
IHC of human cervix using anti-ERBB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB1 Ab at 1:500/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping