Anti-Esp1
- Catalog #
- AB0110
- Category
- Antibodies
- Family
- Other Antibodies
- Source
- Goat
- Application
- WB
- Reactivity
- Mouse
- Description
- Goat polyclonal antibody to Esp1. Exocrine gland secreted peptide 1 is a male-specific pheromone secreted by the extraorbital lacrimal gland into tears, which is recognized by the Vmn2r116/V2rp5 receptor.
- Alternative names
- Exocrine gland-secreted peptide 1 antibody.
- Gene Identifier/Accession#
- Gene ID: 619517
- Form
- Polyclonal antibody supplied as a 200 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 4.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified full recombinant protein produced in E. coli.
- Antigen Sequence
- MEMADQKTNHEADLKNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGLE
- Specificity
- Detects the recombinant protein Esp1 by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Mouse +++ ND ND ND ND -
Rating
Review
2021-02-06 10:26:33Ab works on WB
-
Question
2021-02-06 10:46:03Can I buy 1 mg?
Answer
Yes you can.
Question
2021-02-06 10:33:41Which dilution should be used for WB?
Answer
should be used 1:1000
-
Anti-Esp1 Ab at 1/1,000 dilution; 20 ng of recombinant protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Reviews (1)
Questions & answers (2)
Images
300 €
Quantity / Unit Size
800 µg
Add to shopping cart
Shipping
No Shipping