Anti-beta-Actin

(0) Reviews

(4) References

(0) Validations

(0) Q&A

Catalog #: AB0145
Category: Antibodies
Family: Loading Controls
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Actin proteins are highly conserved and ubiquitously expressed in all eukaryotic cells. These proteins are the major components of the cytoskeleton and involved in various types of cell motility.
Alternative names: ACTB, beta-actin, BRWS1, PS1TP5BP1 antibody.
Gene Identifier/Accession#: Gene ID: 60, ENSG00000075624
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.
Antigen Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE
Specificity: Detects a band of approximately 42 kDa by Western blot in the following human (293A, primary fibroblasts, HaCat, HeLa, HMEC-1, Jurkat, MNT1, U-118, rat (TR-iBRB), mouse (3T3, AtT-20, Hepa, Raw264.7), monkey (COS-7) and canine (D17) whole cell lysates.
Storage: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:250-1:2,000
IF	1:50-1:250
IHC (F)	1:250-1:1,000
IHC (P)	1:250-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (4)

Lousa I, Reis F, Viana S, et al. Biomolecules 2023 Mar	PMID: 36979469
Cardoso MHS, PhD Thesis, NOVA University of Lisbon, Portugal 2018
Morcom, L, Edwards T, Rider E, et al. bioRxiv 2020
Singh SP, de Bruijn MJW, Gago da Graça CV, et al. J Immunol 2020 Jan	PMID: 31836657

Images

	Anti-beta-Actin Ab at 1/500 dilution; lysates at 100 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of mouse kidney using anti-b-Actin antibody and FFPE tissue after heat-induced antigen retrieval. Anti-b-Actin Ab at 1:500/DAB detection.
	Immunofluorescence – anti-beta-Actin Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin;
	IHC of mouse liver using anti-b-Actin antibody and FFPE tissue after heat-induced antigen retrieval. Anti-b-Actin Ab at 1:500/DAB detection.
	Immunofluorescence – anti-beta-Actin Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin;
	IHC of human lymph node using anti-b-Actin antibody and FFPE tissue after heat-induced antigen retrieval. Anti-b-Actin Ab at 1:500/DAB detection.
	Immunofluorescence – anti-beta-Actin Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin;
	IHC of human appendix using anti-b-Actin antibody and FFPE tissue after heat-induced antigen retrieval. Anti-b-Actin Ab at 1:500/DAB detection.
	IHC of human mouse heart using anti-b-Actin antibody and FFPE tissue after heat-induced antigen retrieval. Anti-b-Actin Ab at 1:500/DAB detection.