Anti-INS

(0) Reviews

(0) References

(0) Validations

(0) Q&A

Catalog #: AB0159
Category: Antibodies
Family: Metabolism
Source: Goat
Application: WB, IHC (F), IHC (P)
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin. An increase in blood glucose levels during stimulates insulin release from pancreatic β cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.
Alternative names: IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10 antibody.
Gene Identifier/Accession#: Gene ID: 3630, ENSG00000254647
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant human Insulin produced in E. coli as a fusion protein.
Antigen Sequence: MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN
Specificity: Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	ND	ND
Rat	+++	+++	+++	ND	ND
Mouse	+++	+++	+++	ND	ND
Canine	+++	+++	+++	ND	ND
Monkey	+++	+++	+++	ND	ND

Images

	IHC of human pancreas using anti-INS antibody and FFPE tissue after heat-induced antigen retrieval. Anti-INS Ab at 1:750/DAB detection;
	Anti-INS Ab at 1/1,000 dilution; 20 ng of recombinant protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of mouse stomach using anti-INS antibody and FFPE tissue after heat-induced antigen retrieval. Anti-INS Ab at 1:750/DAB detection;
	IHC of mouse liver using anti-INS antibody and FFPE tissue after heat-induced antigen retrieval. Anti-INS Ab at 1:750/DAB detection;