anti-IL10
- Catalog #
- AB0173
- Category
- Antibodies
- Family
- Growth Factors and Cytokines
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal to IL10. IL10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. It is involved in inflammation and immunoregulation. It down-regulates the expression of MHC class II antigens and Th1 cytokines on macrophages. It also enhances B cell survival, proliferation, and antibody production.
- Alternative names
- CSIF, GVHDS, IL-10, interleukin 10, IL10A, TGIF antibody.
- Gene Identifier/Accession#
- Gene ID: 3586, ENSG00000136634
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant human IL10 produced in E. coli.
- Antigen Sequence
- MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
- Specificity
- Detects endogenous levels of total IL10 by Western blot in whole cell and tissue lysates.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:250-1:5,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of mouse testis using anti-IL10 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-IL10 Ab at 1:750/DAB detection. 
Anti-IL10 Ab at 1/2,500 dilution; 50 µg of total protein lysate per lane; cells were stimulated with inactivated E. coli; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of mouse spleen using anti-IL10 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-IL10 Ab at 1:750/DAB detection. 
IHC of mouse intestine using anti-IL10 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-IL10 Ab at 1:750/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping