Anti-CD5
- Catalog #
- AB0272
- Category
- Antibodies
- Family
- CD Markers
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to CD5. This protein is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are membrane-anchored proteins or secreted mainly found in cells (thymocytes, T lymphocytes and a subset of B lymphocytes) associated with the immune system.
- Alternative names
- LEU1, T1 antibody.
- Gene Identifier/Accession#
- Gene ID: 921, ENSG00000110448
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 105-210 aa of human CD5 produced in E. coli.
- Antigen Sequence
- QSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCG
- Specificity
- Detects endogenous levels of CD5 by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of mouse spleen using anti-CD5 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD5 Ab at 1:750/DAB detection. 
Anti-CD5 Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human appendix using anti-CD5 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD5 Ab at 1:750/DAB detection. 
IHC of human lymph node using anti-CD5 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD5 Ab at 1:750/DAB detection. 
IHC of mouse kidney using anti-CD5 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD5 Ab at 1:750/DAB detection. 
IHC of mouse liver using anti-CD5 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD5 Ab at 1:750/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping