Anti-HSV tag
- Catalog #
- AB0279
- Category
- Antibodies
- Family
- TAG-Antibodies
- Source
- Goat
- Application
- WB
- Reactivity
- Transfected cells
- Description
- Goat polyclonal antibody to HSV epitope. The HSV (herpes simplex virus) tag is derived from the envelope glycoprotein D and it is frequently engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be visualized and analyzed by immunochemical methods.
- Alternative names
- HSV tag antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide QPELAPEDPED produced in E. coli.
- Antigen Sequence
- MQPELAPEDPEDNPMQPELAPEDPEDNPGRPAGKLGTGRRFTTS
- Specificity
- Reacts specifically with HSV-tagged recombinant fusion proteins expressed in transfected mammalian cells or produced by in vitro translation.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 -
Sample WB IHC (F) IHC (P) IF ELISA Transfected cells +++ ND ND ND ND -
Anti-HSV Ab at 1/2,500 dilution; lysates at 20 ng of protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
200 µg
Add to shopping cart
Shipping
No Shipping