Anti-BCL2
- Catalog #
- AB0378
- Category
- Antibodies
- Family
- Cancer
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to BCL2. This protein belongs to a family that act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Regulates cell death by controlling the mitochondrial membrane permeability and appears to function in a feedback loop system with caspases.
- Alternative names
- Apoptosis Regulator Bcl-2, BCL2 Apoptosis Regulator, B-Cell CLL/Lymphoma 2, PPP1R50, Protein Phosphatase 1 Regulatory Subunit 50 antibody
- Gene Identifier/Accession#
- Gene ID: 596, ENSG00000171791
- Form
- Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant affinity purified peptide derived from within residues 143 aa to the N-terminus of human BCL2 produced in E. coli.
- Antigen Sequence
- MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVN
- Specificity
- Detects a band of approximately 25 kDa by Western blot in the following cell lysate: LS174T, Jurkat and HUH.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Monkey +++ ND ND ND ND Canine +++ ND ND ND ND -
Anti-BCL2 Ab at 1:1,000 dilution; 50 µg of total protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping