Anti-gapA
- Catalog #
- AB0415
- Category
- Antibodies
- Family
- Bacteria
- Source
- Goat
- Application
- WB
- Reactivity
- Pseudomonas
- Description
- Goat polyclonal antibody to gapA from Pseudomonas aeruginosa.
- Alternative names
- glyceraldehyde 3-phosphate dehydrogenase, GAPDH antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide (223 aa – stop) derived from Pseudomonas aeruginosa produced in E. coli.
- Antigen Sequence
- TREMELNKKLTGMSFRVPTSDVSVVDLTVELEKEATYAEICAEVKAQSEGALKGILGYTEDKVVATDFRGETCTSVFDADAGIALDGTFV KLVTWYDNEWGYSNKCLEMAKVIAAK
- Specificity
- Detects endogenous levels of gapA by Western blot.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Pseudomonas +++ ND ND ND ND -
Anti-gapA Ab at 1/1,000 dilution; lanes with 30 ng of recombinant fusion protein (C-term); rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
375 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping