Anti-RFP

(0) Reviews

(9) References

(0) Validations

(0) Q&A

Catalog #: AB1140
Category: Antibodies
Family: Fluorescent Proteins
Source: Goat
Application: WB, IHC (F), IHC (P), IF, ELISA
Reactivity: Transfected cells
Description: Goat polyclonal antibody to RFP (Red fluorescent protein). RFP is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma.
Alternative names: Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody.
Gene Identifier/Accession#: N/A
Form: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant RFP peptide produced in E. coli.
Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSNGGMDEVYK
Specificity: In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody also recognizes very well tdTomato and does not cross-react to GFP (green fluorescent protein).
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:2,000
IHC (F)	1:50-1:500
IHC (P)	1:50-1:500
IF	1:50-1:500
ELISA	ND

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA	IEM
Transfected cells	+++	+++	+++	+++	ND	+++

External References (9)

Dinwoodie O, PhD Thesis, King's College London, UK 2024
Endo T, Kadoya K, Suzuki T, et al. NPJ Regen Med 2022 Jan	PMID: 35091563
Wu J, Zhao Z, Shi Y, et al. J Mol Neurosci 2022 Jun	PMID: 35708842
Suzuki T, Kadoya K, Endo T, et al. Cell Mol Neurobiol 2022 Oct	PMID: 36222946
Semerci F, Choi WT, Bajic A, et al. Elife 2017 Jul	PMID: 28699891
Tian DS, Peng J, Murugan M, et al. J Neurosci 2017 Aug	PMID: 28716963
Jiang D, Correa-Gallegos D, Christ S, et al. Nature Cell Biology 2018 Apr	PMID: 29593327
Endo T, Kadoya K, Suzuki Y, et al. Front Cell Neurosci 2019 Jun	PMID: 31316351
Tan Z, Kong M, Wen S, et al. J Bone Miner Res 2020 Jul	PMID: 32662900

Images

	Immunofluorescence in Drosophila larvae NMJ muscle 6/7 expressing RFP in neurons (DyGlutRFP) using 1st Ab anti-RFP at 1/1,000 and 2nd Ab anti-goat IgY conjugated to DyLight®488 at 1/500;
	Anti-RFP Ab at 1/2,000 dilution; 293HEK cells transduced with RFP Ad; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence – anti-RFP Ab in 293HEK cells transfected with RFP at 1/50 dilution; cells were fixed with 4% of PFA;
	Immunogold labeling of epithelium cells, in vivo injected with RFP expressing vector;