Anti-STUB1
- Catalog #
- AB0283
- Category
- Antibodies
- Family
- Cancer
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to STUB1. STUB1 protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. It binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets.
- Alternative names
- CHIP, HSPABP2, NY-CO-7, SCAR16, SDCCAG7, STIP1 homology and U-box containing protein 1, UBOX1 antibody.
- Gene Identifier/Accession#
- Gene ID: 10273, ENSG00000103266
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant human STUB1 protein produced in E. coli.
- Antigen Sequence
- MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
- Specificity
- Detects endogenous levels of STUB1 by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of mouse kidney using anti-STUB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-STUB1 Ab at 1:750/DAB detection. 
Anti-STUB1 Ab at 1/2,500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human pancreas using anti-STUB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-STUB1 Ab at 1:750/DAB detection. 
IHC of mouse brain using anti-STUB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-STUB1 Ab at 1:750/DAB detection. 
IHC of rat retina using anti-STUB1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-STUB1 Ab at 1:750/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping